1.67 Rating by CuteStat

sagemarkprivatewealthservices.com is 8 years 11 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, sagemarkprivatewealthservices.com is SAFE to browse.

PageSpeed Score
98
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

50.63.202.19

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 50.63.202.19)

AAASpell.com - Practice Your Spelling

- aaaspell.com

AAASpell features a comprehensive set of interactive spelling lessons, games and exercises. Unlimited practice is available on each topic which allows thorough mastery of the concepts.

492,929 $ 8,280.00

Cactus Thorns

- vote29.com

Irreverent Barbs on Desert Happingings

6,495,353 $ 240.00

Последни новини от "Интервю"

- inter-view.info

- Последни новини от "Интервю"

3,320,499 $ 480.00

Please Log In

- varsityoptics.com
Not Applicable $ 8.95

JUSTALOTTATANYA.com - Superhero, Cosplay and Comic Book News Blog of S

- justalottatanya.com

Superhero and Comic Book News Blog of Sexy Geek Girl Tanya Tate™, the Cosplay model who dresses up as Marvel Comics and DC Comics characters! This nerd heaven features video and pictures from events like San Diego Comic Con and other fun entertainment events! Tanya also does reviews of all thing geek!

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Cache-Control: max-age=900
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Wed, 29 Apr 2015 03:52:15 GMT
Content-Length: 643
Age: 1
Connection: keep-alive

Domain Information

Domain Registrar: Camelot 42 888, LLC
Registration Date: Apr 23, 2015, 12:00 AM 8 years 11 months 3 weeks ago
Last Modified: Apr 23, 2015, 12:00 AM 8 years 11 months 3 weeks ago
Expiration Date: Apr 23, 2016, 12:00 AM 7 years 11 months 3 weeks ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns49.domaincontrol.com 97.74.104.25 United States of America United States of America
ns50.domaincontrol.com 173.201.72.25 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
sagemarkprivatewealthservices.com A 3599 IP: 50.63.202.19
sagemarkprivatewealthservices.com NS 3599 Target: ns50.domaincontrol.com
sagemarkprivatewealthservices.com NS 3599 Target: ns49.domaincontrol.com
sagemarkprivatewealthservices.com SOA 3599 MNAME: ns49.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2015042301
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 600
sagemarkprivatewealthservices.com MX 3599 Priority: 10
Target: mailstore1.secureserver.net
sagemarkprivatewealthservices.com MX 3599 Target: smtp.secureserver.net

Full WHOIS Lookup

Domain Name: SAGEMARKPRIVATEWEALTHSERVICES.COM
Registrar URL: http://www.wildwestdomains.com
Registrant Name: Thomas Craft
Registrant Organization:
Name Server: NS49.DOMAINCONTROL.COM
Name Server: NS50.DOMAINCONTROL.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.securepaynet.net/whoischeck.aspx?domain=SAGEMARKPRIVATEWEALTHSERVICES.COM&prog_id=JnetDotComs

The data contained in this Registrar's Whois database,
while believed by the registrar to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This information
is provided for the sole purpose of assisting you in obtaining
information about domain name registration records. Any use of
this data for any other purpose is expressly forbidden without
the prior written permission of this registrar. By submitting an
inquiry, you agree to these terms of usage and limitations of warranty.
In particular, you agree not to use this data to allow, enable, or
otherwise make possible, dissemination or collection of this data, in
part or in its entirety, for any purpose, such as the transmission of
unsolicited advertising and solicitations of any kind, including spam.
You further agree not to use this data to enable high volume, automated
or robotic electronic processes designed to collect or compile this data
for any purpose, including mining this data for your own personal or
commercial purposes.

Please note: the owner of the domain name is specified in the "registrant" section.
In most cases, the Registrar is not the owner of domain names listed in this database.